<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3044 3044-30318 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54V, V82A L24I L10I, M36I, N37D, I62V, I64V, I72V  
>3044-30318| codons 4-99
TLWQRPIVTIKIGGQLKEALIDTGADDTVLEEIDLPGRWKPKLIVGIGGFVKVRQYDQVL
VEICGHKAVGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K219R     K43E, K102R, V118I, K122E, D123N  
>3044-30318| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKRKKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTP
DRKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006