<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3041 3041-30313 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M Q58E, G73S L10V, E35D, M36I, N37T, I62V, L63P, A71V, I72V, V77I  
>3041-30313| codons 4-99
TLWQRPVVTIKIGGQLKEALLDTGADDTVLEDITLPGRWKPKMIGGIGGFIKVREYDQVP
IEICGHKVVSTVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, V75T, Y115F, M184V A62V, T215D L100I, K103N   S48SP, V118I, D123E, I135T, T200A, I202V, V245M  
>3041-30313| codons 38-247
CTEMEKEGKIPKIGPENPYNTPVFVIKKKDSTKWRKVTDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAFFSIPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKVEELRQHLLRWGFDTP
DKKHQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006