<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3042 3042-30313 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, I84V, L90M Q58E L10I, I13V, I15V, G16A, K20T, D60E, Q61D, L63P, I64V, I66F, A71T, I72T, T91A, I93V L97M
>3042-30313| codons 4-98
TLWQRPIVTVKVAGQLTEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVREYEDIP
VEFCGHKTTGTVLVGPTPVNVIGRNLMAQVGCTMN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215F K219Q K103KN   V60I, K104KR, V118I, K122E, I135T, Q174H, G196E, F214L  
>3042-30313| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNRSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKHNPDIVIYQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGLFTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006