<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3040 3040-30312 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54L, V82A, I84V, L90M Q58E L10I, N37S, Q61E, L63P, A71V, V77I, I93L  
>3040-30312| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKLIGGIGGFLKVREYDEIP
IEICGHKVIGTVLIGPTPANVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210W, T215Y K219E K103N K238T E44D, A98S, L109I, V118I, K122E, D123N, V179I, T200A, E203D, H208Y, R211K, L228H, V245M  
>3040-30312| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKNKSVTVIDVGDAYFSIPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYMDDLYVGSDLEIGQHRAKIDELRQYLWKWGFYTP
DEKHQKEPPFHWMGYELHPDTWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006