<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3038 3038-30311 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10FI, Q58E, G73S T12K, I13V, L19T, K20T, N37D, Q61R, L63P, A71V, I72L  
>3038-30311| codons 4-99
TLWQRPIVKVKIGGQTTEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFVKVREYDRIP
IEICGHKVLSTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184V A62V, V75I, F77L, F116Y K103N   S68G, T69I, V118I, I135T, T200L, R211K, F214L  
>3038-30311| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKDGIKWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYYSIPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRLKIEELRQHLLKWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006