<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3035 3035-30310 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q Y188L A98G K64KR, K122KE, D123E, D177E, V179C, R211K  
>3035-30310| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIRKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSVPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEICIYQYVDDLLVGSDLEIGQHRTKIEELRQHLLKWGFTTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L23I, F53FL L10I, N37NS, R41RK, D60E, I62V, L63P, I64L, A71T, I72IV, V77I, I93L  
>3035-30310| codons 4-99
TLWQRPIVTIKIGGQLKEAILDTGADDTVLEEMSLPGKWKPKMIGGIGGLVKVRQYEQVP
LEICGHKTVGTVLIGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006