<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3031 3031-30825 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 25

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, L74I, T215F V75S, K219Q G190Q V179D A98S, K122E, I135T, Q174K, T200A, I202V, Q207A, R211A, L228H  
>3031-30825| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSDRWRKISDFRELNKRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKKNPDIDIYQYMDDLYVQSDLEIGQHRAKVEELRAHLLAWGFFTP
DQKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, V11I, G73S I13V, I15V, K20I, M36I, R41K, D60DE, I62V, L63P, A71T, I72L E35NS
>3031-30825| codons 5-99
LWQRPFITVKVGGQLIEALLDTGADDTVLESINLPGKWKPKIIGGIGGFVKVRQYEQVPI
EICGHKTLSTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006