<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3068 3068-30724 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 14

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IV, I84V, L90M L10FI, G73S T12A, I13V, I62V, L63P, I64V, A71T, I72T, V77I, I93L, C95F  
>3068-30724| codons 4-99
TLWQRPIVAVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVRQYDQVP
VEICGHKTTSTVLIGPTPVNVIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74LI, M184V, T215F V75VA, K219E K103N V108I V60I, T69N, A98S, K101Q, V118I, K122E, I135V, Q174K, T200A, I202V, R211K, L228H, Q242H K64KHNQ, T216L
>3068-30724| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIQKKNSNRWRKIADFRELNKRTQDFWEVQLGIPHP
SGLQKNKSVTILDVGDAYFSIPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKKNPDIVIYQYVDDLYVGSDLEIGQHRAKVEELRQHLLKWGFFLP
DEKHQKEPPFHWMGYELHPDKWTVHPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006