<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3067 3067-30402 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V, V82F, L90M L23I, L33F, Q58E I13V, E35D, M36I, N37D, I62V, L63Q, I64V  
>3067-30402| codons 4-99
TLWQRPLVTVKIGGQLKEAILDTGADDTVFEDIDLPGRWKPKIIGGIGGFIKVREYDQVQ
VEICGHKAIGTVVVGPTPFNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219N     E40F, K43E, V60I, W88C, A98S, K122E, I135V, T200A, Q207A, R211K  
>3067-30402| codons 38-247
CTFLEEEGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFCEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELRAHLWKWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006