<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3187 3187-30623 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74LV, M184MV, T215FI K219E K103KN   V60I, T69N, A98S, V118VI, K122E, I142IV, F214L, L228LH, V245M  
>3187-30623| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSNRWRKVVDFRELNKRTQDFWEVQLGIPHP
SGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLITP
DEKHQKEPPFHWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V, V82T, I84V L24I, L33F L10I, I13V, L63P, I64V  
>3187-30623| codons 4-99
TLWQRPIVTVKIGGQLKEALIDTGADDTVFEEMNLPGRWKPKIIGGIGGFIKVRQYDQIP
VEICGHKAIGTVVVGPTPTNVIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006