<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3186 3186-30613 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A   L10I, K14KR, L19LI, N37ND, L63P, I64IM, A71V, V77I  
>3186-30613| codons 4-99
TLWQRPIVTIRIGGQIKEALLDTGADDTVLEEMDLPGRWKPKMIVGIGGFTKVRQYDQIP
MEICGHKVIGTVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, L74LV, L210W, T215Y K219KNRS L100LI, K103N, G190GA   K66KR, K122E, I135T, S162SACG, D177E, E203EK, Q207E, R211RK, K223KE, L228R  
>3186-30613| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKRNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQGSMTKILEPFRKQNPEIVIYQYMDDLYVASDLEIGQHRTKIKELREHLWKWGFYTP
DSKHQEEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006