<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3174 3174-30812 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48M, I54V, V82A L24I, L33F, F53L L10I, K20T, R41K, L63P, A71V, I93L  
>3174-30812| codons 4-99
TLWQRPIVTIKIGGQLTEALIDTGADDTVFEEMNLPGKWKPKMIMGIGGLVKVRQYDQIP
IEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215F   Y188L   K43E, V118I, K122KE, I135V, S162C, D177E, V179VI, G196E, T200A, Q207H, R211K, V245I D113DN
>3174-30812| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGNAYFSIPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPEIIIYQYVDDLLVGSDLEIEQHRAKIEELRHHLLKWGFFTP
DKKHQKEPPFLWMGYELHPDKWTVQPIILP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006