<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3128 3128-30514 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, M184V, L210W, T215Y   K103N, G190A   K43Q, E44D, K102KNRS, V118I, K122E, D123N, K166R, G196E, T200A, Q207E, R211K, I244IV, V245E Q197V
>3128-30514| codons 38-247
CTELEQDGKISKIGPENPYNTPVFAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKSNKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDIVIYQYVDDLYVASDLEIEVHRAKIEELREHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPVELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IV, I84V, L90M L10FI, L33LF, G73T L19LI, E34EQ, G51GA, K55R, R57RK, I62V, L63P, I66IV, A71AV, V77VI  
>3128-30514| codons 4-99
TLWQRPIVTIKIGGQIKEALLDTGADDTVFQEMNLPGRWKPKIIGGIAGFVRVKQYDQVP
IEVCGHKVITTVLIGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006