<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3129 3129-30514 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, G73S I13V, I15V, Q18I, K20IV, M36MI, D60E, I62V, L63P, A71V, I72FL  
>3129-30514| codons 4-99
TLWQRPFVTVKVGGILVEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFVKVRQYEQVP
IEICGHKVLSTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y V75VA, K219N     K43E, E44D, V118I, D121H, K122E, I135T, S162Y, D177G, V179VI, H208Y, D218E, V245K  
>3129-30514| codons 38-247
CTELEEDGKISKIGPENPYNTPVFAIKKKNSTKWRKLADFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLHEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPGIIIYQYVDDLYVGSDLEIGQHRTKIEELRQYLWRWGFYTP
ENKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006