<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3209 3209-40727 Canada 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82L, I84V, L90M   L10V, N37D, K55R, I62V, L63P, I64V, I66V, A71V, T74S, V77I, I85V, I93L  
>3209-40727| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFVRVRQYD
QVPVEVCGHKVIGSVLIGPTPLNVVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69~, L74V, Y115F, Q151M, M184V V75I, N348I Y181C, G190A V179D T58S, V60I, S68G, V90VI, V106I, K122E, Q197R, T200A, F214L, H221Y, L228H, V245M, A272P, K277R, L283I, I293IV, E312H, I329L, I341L, K350R, M357T, T369A, A376T, A400T I63V, F77C, P225F, F227V
>3209-40727| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNSPI
FAVKKKDG~KWRKVIDCRELNKRTQDFWEIQLGIPHPAGLKKKKSITVLDVGDAFFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIDI
CQYVDDLYVASDLEIGRHRAKIEELRQHLLRWGLTTPDKKYQKEFPVHWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTEVVPLTEEAE
LELAENREILKHPVHGVYYDPSKDLIAELQKQGQGQWTYQLYQEPFKILRTGKYARTRGA
HTNDVKQLAEAVQKITTESIVIWGKTPKFKLPIQKETWET

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006