<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3209 3209-40727 Canada 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82L, I84V, L90M   L10V, N37D, K55R, I62V, L63P, I64V, I66V, A71V, T74S, V77I, I85V, I93L  
>3209-40727| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFVRVRQYD
QVPVEVCGHKVIGSVLIGPTPLNVVGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006