<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3209 3209-31023 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 12

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82L, I84V, L90M L10F, G73C N37D, I62V, L63P, I66V, A71V, T74S, V77I, I85V, I93L  
>3209-31023| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFVKVRQYD
QVPIEVCGHKVICSVLIGPTPLNVVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69~, L74V, Y115F, Q151M V75I, N348I Y181C, G190S   T58S, V60I, S68G, V106I, K122E, S163C, T200A, F214L, H221Y, L228H, V245M, A272P, K277R, L283I, E312H, I329L, I341L, M357S, T369A, A376T, K388R, A400T I63V, F77C, P225F, F227V
>3209-31023| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNSPI
FAVKKKDG~KWRKVIDCRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAFFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSCMTKILEPFRKQNPDIVI
CQYMDDLYVSSDLEIGQHRAKIEELRQHLLRWGLTTPDKKYQKEFPVHWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTEVIPLTEEAE
LELAENREILKHPVHGVYYDPSKDLIAELQKQGQGQWTYQLYQEPFKILKTGKYARSRGA
HTNDVKQLAEAVQKITTESIVIWGKTPRFKLPIQKETWET

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006