<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3182 3182-30514 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R K70T, V75A Y181C, G190A   V60I, S68G, K73M, K122E, D123DN, I135IT, S162D, T165I, Q174H, T200A, Q207E, R211K, F214L, H221Y H235HR
>3182-30514| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKRKDGTTWRMLADFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQDSMIKILEPFRKHNPDIVICQYMDDLYVASDLEIGQHRAKIEELREHLLKWGLTTP
DKKYQKEPPFLWMGYELRPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, L76V, V82A L33F, K43T T12I, I13V, K20R, E35D, M36I, N37D, R57RK, Q61DE, I62V, L63P, I64V, A71V, I93L  
>3182-30514| codons 4-99
TLWQRPLVIVKIGGQLREALLDTGADDTVFEDIDLPGRWTPKLIGGIGGFVKVKQYDEVP
VEICGHKVIGTVVVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006