<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3096 3096-30513 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215Y K219Q K103N K238T T39A, A98S, K122P, S162CDGY, Q174QK, R211K, L228H  
>3096-30513| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKNKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKKNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTP
DQKHQKEPPFHWMGYELHPDTWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82C, L90M L10F, G73S I13M, I15V, G17E, K20V, L24F, M36I, N37D, K43KR, R57K, D60E, I62V, L63P, A71V, I72R  
>3096-30513| codons 4-99
TLWQRPFVTMKVGEQLVEALFDTGADDTVLEEIDLPGRWRPKMIGGIGGFVKVKQYEQVP
IEICGHKVRSTVLVGPTPCNIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006