<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3089 3089-30430 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48MV, I54T, V82A, I84V L33LF, K43T L10I, K20R, E34R, E35D, M36I, I62IV, L63P, A71V, I72V, V77I, I93L  
>3089-30430| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVFRDINLPGRWTPKMIVGIGGFTKVRQYDQVP
IEICGHKVVGTVLIGPTPANVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y       T39TA, K43KN, K122E, I135V, I142V, S162C, K173KE, Q174QE, D177E, T200A, L210F, R211RK, L228H, I244V  
>3089-30430| codons 38-247
CAELENEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSP
AIFQCSMTKILEPFREENPEIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLFKWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPVVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006