<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3087 3087-30417 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48M, I54V, V82A, L90M F53L, Q58E, G73S L10I, T12I, I13V, I15V, K20I, E35D, M36I, N37D, I62V, L63P, A71V, I72IMT  
>3087-30417| codons 4-99
TLWQRPIVIVKVGGQLIEALLDTGADDTVLEDIDLPGRWKPKMIMGIGGLVKVREYDQVP
IEICGHKVTSTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, L210W, T215F K219Q   A98G E44ED, V60I, D123E, I135T, S162Y, G196K, T200I, E203D, Q207E, H208Y, R211K, E224D, L228H, Q242H  
>3087-30417| codons 38-247
CTELEKDGKISKIGPENPYNTPIFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIKQHRIKIDELREYLWKWGFFTP
DQKHQKDPPFHWMGYELHPDKWTVHPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006