<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3202 3202-30717 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   Y188Y*FL, G190GS A98G T39K, K43E, I142T, V245E  
>3202-30717| codons 38-247
CKELEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLLVSSDLEIGQHRTKIEELRQHLLRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, L33F, G73S R41K, I62IV, L63P, I66V, H69HR, I72T, I93L, C95F  
>3202-30717| codons 4-99
TLWQRPFVTIKIGGQLKEALLDTGADDTVFEEMNLPGKWKPKIIGGIGGFVKVRQYDQVP
IEVCGRKATSTVLVGPTPVNVIGRNLMTQLGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006