<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3199 3199-30716 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y V75M G190S   K43KDEN, E44D, K166R, V179I, T200TA, R211K, V245MT  
>3199-30716| codons 38-247
CTELENDGKISKIGPENPYNTPVFAIKKKDSTKWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDIIIYQYVDDLYVSSDLEIGQHRAKIEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPITLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, V82T, L90M   L10I, I15V, L19I, K20R, E35D, M36I, R41K, R57K, I62V, L63P, I72M, T74S, I93L  
>3199-30716| codons 4-99
TLWQRPIVTIKVGGQIREALLDTGADDTVLEDINLPGKWKPKIIVGIGGFIKVKQYDQVP
IEICGHKAMGSVLVGPTPTNIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006