<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3200 3200-30716 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, L90M K43T L10R, L19I, K20R, E35D, M36I, K55R, R57K, L63P, A71V, V77I, Q92K, I93L  
>3200-30716| codons 4-99
TLWQRPRVTIKIGGQIREALLDTGADDTVLEDINLPGRWTPKIIGGIGGFVRVKQYDQIP
IEICGHKVIGTVLIGPTPTNIIGRNLMTKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, Y115F, M184V, L210W, T215Y D67G, V75IT K103N   S68G, K101KR, K122E, D123DN, G196E, R211N, V245E  
>3200-30716| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKGGTKWRKVTDFRELNKRTQDFWEVQLGIPHP
AGLRKNKSVTVLDVGDAFFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIEELRQHLWNWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006