<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3014 3014-30429 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54M, L76V, I84V, L90M L33F L10I, I13V, L63P, I64V, A71V, I72V, V77I, I93L  
>3014-30429| codons 4-99
TLWQRPIVTVKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKIVGGIGGFMKVRQYDQIP
VEICGHKVVGTVVIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, M184V, L210W, T215Y K219R K103N V108I, K238T T39K, K43E, E44D, V118I, V179VI, E203K, Q207E, H208Y, R211K, K223E, V245K H235HR
>3014-30429| codons 38-247
CKELEEDGKISKIGPENPYNTPVFAIKKKDSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTILDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYVDDLYVGSDLEIGQHRTKIKELREYLWKWGFYTP
DRKHQEEPPFLWMGYELRPDTWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006