<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3013 3013-30402 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54S, V82A Q58E L10I, I15V, K20R, E35D, M36I, D60E, I62V, L63P, A71V, P79A, I93L  
>3013-30402| codons 4-99
TLWQRPIVTIKVGGQLREALLDTGADDTVLEDINLPGRWKPKMIVGIGGFSKVREYEQVP
IEICGHKVIGTVLVGATPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, V75M, M184V, L210W, T215Y F77L, K219KR K103N   K43Q, E44D, V118I, K122E, I135L, S162D, K166R, G196E, R211K, L228H, Q242H, V245M  
>3013-30402| codons 38-247
CTELEQDGKISKIGPENPYNTPVFAIKKKDSDKWRKLMDLRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQDSMTRILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTP
DRKHQKEPPFHWMGYELHPDKWTVHPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006