<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3010 3010-30716 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 20

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L10F T12P, I13V, K20I, E35D, M36I, N37ND, I62V, L63P, I64V, T74S  
>3010-30716| codons 4-99
TLWQRPFVPVKIGGQLIEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFVKVRQYDQVP
VEICGHKAIGSVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115F, Q151M, M184MV A62V, V75I, F77FL, F116Y, T215V, K219Q K101P, Y181C   K64R, S68R, V90VI, L109LM, V118I, K122E, I135T, K173N, V179I, I202V, R211K, F214L, H221HY, L228LH  
>3010-30716| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIRRKDRTKWRKLIDLRELNKRTQDFWEIQLGIPHP
AGLPKKKSVTVMDVGDAFYSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRNQNPDIIICQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGLVTP
DQKYQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006