<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3010 3010-30226 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, V82A, L90M L10F T12P, I13V, K20I, E35D, M36I, N37D, I62V, L63P, I64V, T74S  
>3010-30226| codons 4-99
TLWQRPFVPVKIGGQLIEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFLKVRQYDQVP
VEICGHKAIGSVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115F, Q151M A62V, V75I, F77L, F116Y, T215V, K219Q K101P, Y181C   K49KR, K64R, S68R, V90VI, L109M, V118I, K122E, I135T, K173N, V179I, I202V, R211K, F214L, H221Y, L228LH  
>3010-30226| codons 38-247
CTEMEKEGKISRIGPENPYNTPVFVIRRKDRTKWRKLIDLRELNKRTQDFWEIQLGIPHP
AGLPKKKSVTVMDVGDAFYSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRNQNPDIIICQYMDDLYVGSDLEIGQHRTKVEELRQHLLKWGLVTP
DQKYQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006