<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3008 3008-30224 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65R, D67N, Q151M A62AV, V75I, F116Y, T215V, K219Q Y181C V108I T39A, I94L, K101Q, K102KQ, G112A, D123E, T139A, A158S, S162D, K166R, D177E, V189I, H208Y, R211K, D218E, L228H, P243PS, V245MT S68SDGN
>3008-30224| codons 38-247
CAELEKEGKISKIGPENPYNTPVFVIKRKNNTKWRKLIDFRELNKRTQDFWEVQLGLPHP
AGLQQKKSVTILDVADAYYSVPLDKEFRKYTAFTIPSINNEAPGIRYQYNVLPMGWKGSP
SIFQDSMTRILEPFRKQNPEIVICQYMDDLYIGSDLEIGQHRTKIEELRQYLLKWGFVTP
EQKHQKEPPFHWMGYELHPDKWTVQSITLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M   L10I, N37D, K55R, I62V, L63P, I64L, A71T, I72V, V77I, I93L, C95F  
>3008-30224| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKLIGGIGGFVRVRQYDQVP
LEICGHKTVGTVLIGPTPANIIGRNLMTQLGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006