<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3002 3002-30219 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, Y115F, M184V, T215Y   K103N, Y181C   T39A, S68G, K122E, D123E, I135T, S162C, D177DN, G196E, T200TI, I202IV, R211T, V245T N54I
>3002-30219| codons 38-247
CAEMEKEGKISKIGPEIPYNTPVFAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAFFSVPLDEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPNIVICQYVDDLYVGSDLEIEQHRIKVEELRQHLLTWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPITLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48M, I54V, V82A, L90M F53L L10I, T12Q, I15V, L19P, K20M, E35ED, M36IV, R41K, I62V, L63P, A71I, T74S, I93L  
>3002-30219| codons 4-99
TLWQRPIVQIKVGGQPMEALLDTGADDTVLEDVNLPGKWKPKMIMGIGGLVKVRQYDQVP
IEICGHKIIGSVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006