<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3001 3001-30219 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, V82C, L90M L10F, L33F, G73C T12E, G16A, L19I, N37T, R41RK, L63P, I64V, I72L, I93L  
>3001-30219| codons 4-99
TLWQRPFVEIKIAGQIKEALLDTGADDTIFEEMTLPGKWKPKIVGGIGGFLKVRQYDQIP
VEICGHKALCTVLVGPTPCNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70KEGR, L74I, M184V, L210W, T215F D67S, V75M, K219Q K103N   T69N, V118I, K122E, I135L, S162D, T200A, Q207E, D218E, L228H  
>3001-30219| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKSSNRWRKIMDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQDSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELREHLWRWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006