<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3004 3004-30716 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 21

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, L210W, T215Y K219E Y181C, G190A   E44D, T69N, K101KQ, V118I, D121H, K122E, D177E, E203D, H208Y, R211K, L228H  
>3004-30716| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAYFSIPLHEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVICQYVDDLYVASDLEIGQHRTKIDELRQYLWKWGFYTP
DEKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I47IV, G48V, I54V, V82A, L90M Q58E L10I, I15V, L19I, K20R, E35D, M36I, N37D, I62V, L63V, I72V, T74S, I85IV, L89M  
>3004-30716| codons 4-99
TLWQRPIVTIKVGGQIREALLDTGADDTVLEDIDLPGRWKPKLVVGIGGFVKVREYDQVV
IEICGHKAVGSVLVGPTPANIVGRNMMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006