<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3159 3159-30625 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115F, M184V   Y181C, G190A   K104KR, V106VI, V118VI, D123E, D177E, V179C, L193F, I202V, R211Q, F214L  
>3159-30625| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKRSITVLDVGDAFFSIPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEICICQYVDDLYVASDFEIGQHRTKVEELRQHLLQWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82VA, I84IV, L90LM   N37S, I62V, L63P, I64L, A71AV, V77I, I93L  
>3159-30625| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQVP
LEICGHKVIGTVLIGPTPANVIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006