<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3158 3158-30529 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, G73T I62V, L63P, I64V, I66IV, A71T, I72V, V77VI  
>3158-30529| codons 4-99
TLWQRPFVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVRQYDQVP
VEVCGHKTVTTVLIGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210*SW, T215Y D67G, K219Q K101KE, G190A   E44D, V60I, S68G, K103R, V118I, K122E, D123N, I135T, S162SDGN, E194EK, H208HY, D218E, D237DE, V245E  
>3158-30529| codons 38-247
CTELEKDGKISKIGPENPYNTPIFAIKKKGGTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLEKRKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQNSMTKILEPFRKQNPDIVIYQYVDDLYVASDLKIGQHRTKIEELRQYLWRWGFYTP
EQKHQKEPPFLWMGYELHPEKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006