<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3124 3124-30428 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M V11I, G73S L10I, T12P, K14R, E35D, N37D, K45R, L63P, A71V, I72L, V77VI, I93L  
>3124-30428| codons 4-99
TLWQRPIIPIRIGGQLKEALLDTGADDTVLEDMDLPGRWKPRIIGGIGGFVKVRQYDQIP
IEICGHKVLSTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F V75M, K219Q K101E, K103N   T39A, V60I, A98S, K122E, I135T, E138A, I142V, T200A, D218E, V245T  
>3124-30428| codons 38-247
CAELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHP
SGLEKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNATPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFFTP
EQKHQKEPPFLWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006