<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3122 3122-30423 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, L90M L10F, G73T K14R, K20I, M36I, L63P, I64V, I72IV, I93L  
>3122-30423| codons 4-99
TLWQRPFVTIRIGGQLIEALLDTGADDTILEEINLPGRWKPKIVGGIGGFIKVRQYDQIP
VEICGHKAVTTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   Y181YC   K43KE, V90VI, S117SA, K122E, I135T, I142IT, S162Y, Q174QH, Q207QAEP, H208HY, R211RK, L228R N57H
>3122-30423| codons 38-247
CTELEEEGKISKIGPENPYHTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKKKKSVTVLDVGDAYFAVPLDEDFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKHNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRPYLLKWGFYTP
DKKHQKEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006