<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3121 3121-30422 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K219N     K43E, V90I, V118I, D123E, I142V, I178M, E203D, Q207K, H208Y, R211K  
>3121-30422| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEIQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVIYQYMDDLYVGSDLEIGQHRTKIDELRKYLWKWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M Q58E, G73S I13IV, I15V, K20I, E35D, M36I, N37E, D60E, L63P, A71V, I93L V11Y
>3121-30422| codons 4-99
TLWQRPLYTVKVGGQLIEALLDTGADDTVLEDIELPGRWKPKIIGGIGGFVKVREYEQIP
IEICGHKVISTVLVGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006