<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3057 3057-30407 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54S, V82A, L90M L33F, K43T L10I, K20R, E34N, E35D, M36I, N37S, R57K, D60DE, I62V, L63P, A71V, I93L K70KAET
>3057-30407| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVFNDISLPGRWTPKMIVGIGGFSKVKQYEQVP
IEICGHTVIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y D67G, K219N K103N   T39A, K43KE, E44D, K64H, V118I, K122E, I135V, S162C, G196E, T200TA, E203K, Q207E, R211K, K223E, V245K  
>3057-30407| codons 38-247
CAELEEDGKISKIGPENPYNTPVFAIHKKGSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRAKIKELREHLWKWGFYTP
DNKHQEEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006