<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3054 3054-30402 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I L10I, T12E, K20KR, E35D, M36I, L63P, A71V, Q92K, I93L  
>3054-30402| codons 4-99
TLWQRPIVEIKIGGQLREALIDTGADDTVLEDINLPGRWKPKIIGGIGGFVKVRQYDQIP
IEICGHKVIGTVLVGPTPANIIGRNLLTKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, T215FI K219Q K103N   V60I, V118I, I135T, G196E, T200A, E204D, F214L, D237E  
>3054-30402| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIEQHRAKIEDLRQHLLRWGLITP
DQKHQKEPPFLWMGYELHPEKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006