<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3150 3150-30610 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K219N Y181C, G190A K238T K43E, E44A, V118I, T165I, G196R, R211N, V245E  
>3150-30610| codons 38-247
CTELEEAGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMIKILEPFRKQNPDIVICQYMDDLYVASDLEIRQHRTKIEELRQHLWNWGFYTP
DNKHQKEPPFLWMGYELHPDTWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54S, V82A L33F, K43T, T74TP L10I, I13V, K14R, L19Q, R41RK, L63T, A71V, V77I, I93L  
>3150-30610| codons 4-99
TLWQRPIVTVRIGGQQKEALLDTGADDTVFEEMNLPGKWTPKLIVGIGGFSKVRQYDQIT
IEICGHKVIGPVLIGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006