<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3149 3149-30506 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I L10I, I15V, E35D, M36I, P39Q, R41K, D60E, I62V, L63P, I64V, A71V, I93L  
>3149-30506| codons 4-99
TLWQRPIVTIKVGGQLKEALIDTGADDTVLEDINLQGKWKPKLIGGIGGFVKVRQYEQVP
VEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115YF, M184V   Y181C V179DE S68N, D123E, I135R, T200TI, I202IV, R211AT, F214L  
>3149-30506| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKRKDNTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAFFSVPLDKEFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIEICQYVDDLYVGSDLEIGQHRIKVEELRQHLLTWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006