<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3148 3148-30506 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54V, V82A L33I, F53L, N83D L10I, I13V, K14M, K20R, M36I, N37D, L63P, I64V, A71V, T91S  
>3148-30506| codons 4-99
TLWQRPIVTVMIGGQLREALLDTGADDTIIEEIDLPGRWKPKIIGGIGGLVKVRQYDQIP
VEICGHKVIGTVLVGPTPADIIGRNLLSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, M184MIV, T215F   K103N, Y181C   K104KR, K122E, I135V, I142T, E169D, G196R, T200A, H208Y, R211K, K223Q, L228R  
>3148-30506| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNRSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGTRYQYNVLPQGWKGSP
AIFQSSMTKILDPFRKQNPDIVICQYVDDLYVGSDLEIRQHRAKIEELRQYLLKWGFFTP
DKKHQQEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006