<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3147 3147-30506 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, T215F K219Q K103N, Y181C   T39TA, A98S, K122E, I135V, H208Y, R211K, D218E, L228H, V245M  
>3147-30506| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHP
SGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQYLLKWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54A, V82F, L90M   L10I, N37K, R41N, I62V, L63P, I64V, A71V, V77I, I93L  
>3147-30506| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMKLPGNWKPKIIGGIGGFAKVRQYDQVP
VEICGHKVIGTVLIGPTPFNIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006