<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3082 3082-30430 Canada 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219E K103S   T39K, S68G, K102R, V106I, K122E, K173A, Q174R, T200A, Q207E, R211K, V245Q I63K
>3082-30430| codons 38-247
CKELEKEGKISKIGPENPYNTPVFAKKKKNGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKRSKSITVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRARNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELREHLWKWGFYTP
DEKHQKEPPFLWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73S L10I, T12S, I15V, L19I, M36I, R41RK, Q61H, L63P, H69K, A71V, I72L, I93L I13N
>3082-30430| codons 4-99
TLWQRPIVSNKVGGQIKEALLDTGADDTVLEEINLPGKWKPKIIGGIGGFIKVRQYDHIP
IEICGKKVLSTVLVGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006