<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3081 3081-30425 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, I84V L10F, L24I K20R, M36I, N37ND, R41K, K43I, D60N, L63P, A71V  
>3081-30425| codons 4-99
TLWQRPFVTIKIGGQLREALIDTGADDTVLEEIDLPGKWIPKIIGGIGGFVKVRQYNQIP
IEICGHKVIGTVLVGPTPTNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Q151M       S68G, T69I, K122E, I135V, S162C, I178IM, G196R  
>3081-30425| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKRKDGIKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPMGWKGSP
AIFQCSMTKILEPFRKQNPDMVIYQYMDDLYVGSDLEIRQHRTKIEELRQHLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006