<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3078 3078-30404 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82S L10F, L24I, F53FL, Q58E K20R, E35D, M36I, N37D, R41K, D60E, I62V, L63P, I64V, T74S  
>3078-30404| codons 4-99
TLWQRPFVTIKIGGQLREALIDTGADDTVLEDIDLPGKWKPKIIGGIGGLVKVREYEQVP
VEICGHKAIGSVLVGPTPSNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215F K219Q K103N   T39A, K43E, T69N, V118I, K122P, D123E, I135T, D177E, F214L, K223Q, L228H, Q242H  
>3078-30404| codons 38-247
CAELEEEGKISKIGPENPYNTPVFAIKKKNSNRWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDPEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFTP
DQKHQQEPPFHWMGYELHPDKWTVHPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006