<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1613 1613-30714 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, L90M   L10I, L19Q, K20M, E35D, M36I, K43KR, I62V, L63H, I64V, V82VI, I85IV, I93L  
>1613-30714| codons 4-99
TLWQRPIVTIKIGGQQMEALLDTGADDTVLEDINLPGRWRPKIIGGIGGFIKVRQYDQVH
VEICGHKAIGTVLVGPTPINIVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74LV K219Q K103KN, Y181YC   V60VI, K122KE, D218E, V245VM T69TNSY
>1613-30714| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSYRWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTP
EQKHQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006