<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1735 1735-30502 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I54V, V82T, L90M G73T L10I, K20R, E35D, M36I, N37D, R57K, I62V, L63P, C67F, H69Q, A71V, Q92K  
>1735-30502| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTILEDIDLPGRWKPKMIGGIGGFVKVKQYDQVP
IEIFGQKVITTVLVGPTPTNIIGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, V75T, L210W, T215Y A62V, L74LF, K219R Y188YFHL, G190GRS   K43N, E44D, V118I, K122E, Q207E, R211K, D218E  
>1735-30502| codons 38-247
CTELENDGKISKIGPENPYNTPVFVIKKKNSDKWRKFTDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLLVSSDLEIGQHRTKIEELREHLWKWGFYTP
ERKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006