<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1270 1270-30403 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, L74LI, L210LW, T215TNSY V75VAIT, K219KN Y181C V108I S68SG, D121HY, K122E, K173N, Q174K, D177E, I178IL, R211K, H221HY, L228LH, P243PT, V245VE  
>1270-30403| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKITDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTILDVGDAYFSVPLYEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRNKNPELVICQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTP
DNKYQKEPPFHWMGYELHPDKWTVQTIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54IV, V82VA L24LI, Q58QE L10LI, R41RK, L63LP, I72V  
>1270-30403| codons 4-99
TLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMNLPGKWKPKIIGGIGGFVKVREYDQIP
IEICGHKAVGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006