<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1269 1269-30318 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54M, L76V, I84V, L90M L10F, L89V I13V, G16A, K20M, L33V, K55R, I62V, L63P, A71V  
>1269-30318| codons 4-99
TLWQRPFVTVKIAGQLMEALLDTGADDTVVEEMNLPGRWKPKIVGGIGGFMRVRQYDQVP
IEICGHKVIGTVVVGPTPVNVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75M, M184V, L210W, T215Y F77L, K219N K103KN   E44ED, T69TS, A98S, V118I, K122E, T200R, Q207E, R211K, L228H  
>1269-30318| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKDSSKWRKLMDLRELNKRTQDFWEVQLGIPHP
SGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRRKIEELREHLWKWGFYTP
DNKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006