<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1267 1267-30314 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48M, I50V, I54V, V82A L33F, K43T, F53L, Q58E L10I, K20R, E35D, M36I, D60E, I62V, L63P, T74S, I85V, L89M  
>1267-30314| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVFEDINLPGRWTPKMIMGVGGLVKVREYEQVP
IEICGHKAIGSVLVGPTPANIVGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y K219R K103N   K43E, E44A, V118I, K122E, D123S, I142V, K166R, Q207E, R211K  
>1267-30314| codons 38-247
CTELEEAGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDESFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTP
DRKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006